Adrenomedullin (22-52) human - 1 mg
CAS Number: 159899-65-7Molecular Weight: 3573.88Salt Form: TFAPurity: >96%Sequence (3-letter): Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2Sequence (1-letter): TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2Storage: -20 °C or belowAdrenomedullin (22-52) is an andrenomedullin (ADM) antagonist which blocks production of cAMP. In addition it antagonizes the calcitonin generelated peptide (CGRP) receptor.
Supplier Catalog Number |
331-82 |
---|---|
Shipping conditions |
Room temperature |
Storage Temperature |
-20°C |
Supplier name |
Echelon Biosciences |
CPV Codification | 12352209 |
---|---|
Nacres Codification | NA.26 |
UNSPSC Codification | 33696500-0 |
From
€546.00
Total
€546.00
In stock
- SKU
- P00385975::1 mg
No surprise after checkout. All fees included
Your satisfaction first: door delivery with guaranteed replacement
Dedicated Scientific Support to select & use
Recently Viewed Products
of