ACTH (7-38) human / Corticotropin Inhibiting Peptide (7-38) - 5 mg
CAS Number: 68563-24-6Molecular Weight: 3656.92Salt Form: TFAPurity: >96%Sequence (3-letter): Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OHSequence (1-letter): FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE-OHStorage: -20 °C or belowACTH (7-38) or Corticotropin Inhibiting Peptide (CIP) (7-38) is a fragment of Adrenocorticotropic Hormone which inhibits ACTH stimulated adenylate cyclase. It can acts as an antagonist of ACTH receptors.
Supplier Catalog Number |
111-45 |
---|---|
Shipping conditions |
Room temperature |
Storage Temperature |
-20°C |
Supplier name |
Echelon Biosciences |
From
€1,106.00
Total
€1,106.00
In stock
- SKU
- P00385878::5 MG
No surprise after checkout. All fees included
Your satisfaction first: door delivery with guaranteed replacement
Dedicated Scientific Support to select & use
Recently Viewed Products
of