Big Endothelin-2 (1-37) human - 0.5 mg

CAS Number: 132699-72-0Molecular Weight: 4184.89Salt Form: TFAPurity: >95%Sequence (3-letter): Cys-Ser-Cys-Ser-Ser-Trp-Leu-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Gln-Thr-Ala-Pro-Tyr-Gly-Leu-Gly-Asn-Pro-Pro-OH [Cys1-Cys15 Cys3-Cys11]Sequence (1-letter): CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OHStorage: -20 °C or belowBig Endothelin-2 is the precursor to the vasoconstricting peptide Endothelin-2 (ET-2). It is hydrolyzed by endothelin converting enzyme (ECE).

Supplier Catalog Number

331-40

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
From
€570.00
Total €570.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use