Big Endothelin 1 (1-39) rat - 0.5 mg

CAS Number: 135842-15-8Molecular Weight: 4390.05Salt Form: TFAPurity: >95%Sequence (3-letter): Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-Arg-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser-OH [Cys1-Cys15 Cys3-Cys11]Sequence (1-letter): CSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGSPSRS-OHStorage: -20 °C or belowBig Endothelin (1-39) is the precursor to the rat vasoconstricting peptide endothelin-1. It is cleaved by endothelin-converting enzyme (ECE).

Supplier Catalog Number

335-50

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
From
€570.00
Total €570.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use