Big Endothelin 1 (1-39) porcine - 1 mg

CAS Number: 120796-99-8Molecular Weight: 4385.03Salt Form: TFAPurity: >95%Sequence (3-letter): Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser-OH [Cys1-Cys15 Cys3-Cys11]Sequence (1-letter): CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS-OHStorage: -20 °C or belowBig Endothelin (1-39) is the precursor to the porcine vasoconstricting peptide endothelin-1. It is cleaved by endothelin-converting enzyme (ECE).

Supplier Catalog Number

334-10

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
From
€945.00
Total €945.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use