Big Endothelin 1 (1-39) porcine - 0.5 mg
CAS Number: 120796-99-8Molecular Weight: 4385.03Salt Form: TFAPurity: >95%Sequence (3-letter): Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser-OH [Cys1-Cys15 Cys3-Cys11]Sequence (1-letter): CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS-OHStorage: -20 °C or belowBig Endothelin (1-39) is the precursor to the porcine vasoconstricting peptide endothelin-1. It is cleaved by endothelin-converting enzyme (ECE).
Supplier Catalog Number |
334-10 |
---|---|
Shipping conditions |
Room temperature |
Storage Temperature |
-20°C |
Supplier name |
Echelon Biosciences |
From
€570.00
Total
€570.00
In stock
- SKU
- P00385976::0.5 mg
No surprise after checkout. All fees included
Your satisfaction first: door delivery with guaranteed replacement
Dedicated Scientific Support to select & use
Recently Viewed Products
of