Beta Amyloid [Glu11] (1-40) human - HFIP - 0.5 mg

Molecular Weight: 4327.18Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OHSequence (1-letter): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OHStorage: -20 °C or belowHexafluoroisopropanol (HFIP) treatment of Beta Amyloid (1-40) (Cat# 641-10) removes preexisting structures (b-sheets aggregation ...) in the lyophilized peptide and is important for controlled aggregation studies. The peptide appears as a clear film in the vial.

Supplier Catalog Number

641-01

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
From
€331.00
Total €331.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use