Beta Amyloid [Glu11] (1-40) human - 0.5 mg
CAS Number: 131438-79-4Molecular Weight: 4327.18Salt Form: TFAPurity: >96%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OHSequence (1-letter): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OHStorage: -20 °C or belowSolubility:  water 1mg/mlBeta amyloid (1-40) along with beta amyloid (1-42) (catalog # 641-15) is one of the two main variants of the amyloid β peptide involved in Alzheimer's disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimer's disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models.References1. Roher A. et al. (1996) “Morphology and Toxicity of Ab-(1–42) Dimer Derived from Neuritic and Vascular Amyloid Deposits of Alzheimer’s Disease†J. Biol. Chem. 34: 20631–20635.2.Tennent G.A. Lovat L.B. and Pepys M.B. (1995) “
Supplier Catalog Number |
641-10 |
---|---|
Shipping conditions |
Room temperature |
Storage Temperature |
-20°C |
Supplier name |
Echelon Biosciences |
From
€189.00
Total
€189.00
In stock
- SKU
- P00386139::0.5 mg
No surprise after checkout. All fees included
Your satisfaction first: door delivery with guaranteed replacement
Dedicated Scientific Support to select & use
Recently Viewed Products
of