Beta Amyloid [Gln11] (1-40) human - 1 mg

Molecular Weight: 4326.19Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OHSequence (1-letter): DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV(OH)Storage: -20 °C or belowBeta amyloid (1-40) along with beta amyloid (1-42) is one of the two main variants of the amyloid β peptide involved in Alzheimer’s disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimer’s disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models. This analog has Gln instead of Glu at position 11.

Supplier Catalog Number

641-11

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
From
€432.00
Total €432.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use