Beta Amyloid [Gln 22] (1-42) human - 10 mg

Molecular Weight: 4510.32Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OHSequence (1-letter): DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA-OHStorage: -20 °C or belowBeta Amyloid [Gln 22] (1-42) contains the E22Q mutation a point mutation that substitutes glutamine for glutamic acid at position 22 also known as the "Dutch" mutant. The E22Q mutation leads to increased deposition rates of the AβE22Q peptide onto preseeded fibrils and is associated with greater toxicity.

Supplier Catalog Number

642-30

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
From
€5,735.00
Total €5,735.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use