Beta Amyloid [Gln 22] (1-42) human - 1 mg
Molecular Weight: 4510.32Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OHSequence (1-letter): DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA-OHStorage: -20 °C or belowBeta Amyloid [Gln 22] (1-42) contains the E22Q mutation a point mutation that substitutes glutamine for glutamic acid at position 22 also known as the "Dutch" mutant. The E22Q mutation leads to increased deposition rates of the AβE22Q peptide onto preseeded fibrils and is associated with greater toxicity.
Supplier Catalog Number |
642-30 |
---|---|
Shipping conditions |
Room temperature |
Storage Temperature |
-20°C |
Supplier name |
Echelon Biosciences |
From
€706.00
Total
€706.00
In stock
- SKU
- P00386174::1 mg
No surprise after checkout. All fees included
Your satisfaction first: door delivery with guaranteed replacement
Dedicated Scientific Support to select & use
Recently Viewed Products
of