Beta Amyloid [Gln 22] (1-40) human - 1 mg

CAS Number: 144410-00-4 Molecular Weight: 4326.19 Salt Form: TFA Purity: >95% Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV-OH Storage: -20 °C or below

Supplier Catalog Number

 640-20

Shipping conditions

 Room temperature

Storage Temperature

 -20°C

Supplier name

 Echelon Biosciences
From
€663.00
Total €663.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use