Beta Amyloid (42-1) reverse human - 0.5 mg
CAS Number: 317366-82-8Molecular Weight: 4514.12Salt Form: TFAPurity: >95%Sequence (3-letter): Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OHSequence (1-letter): AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD-OHStorage: -20 °C or belowBeta amyloid (42-1) is the reverse of beta amyloid (1-42) and is used as an inactive control peptide for beta amyloid (1-42).
Supplier Catalog Number |
641-69 |
---|---|
Shipping conditions |
Room temperature |
Storage Temperature |
-20°C |
Supplier name |
Echelon Biosciences |
From
€628.00
Total
€628.00
In stock
- SKU
- P00386165::0.5 mg
No surprise after checkout. All fees included
Your satisfaction first: door delivery with guaranteed replacement
Dedicated Scientific Support to select & use
Recently Viewed Products
of