Beta Amyloid (40-1) reverse human - 0.5 mg

CAS Number: 144409-99-4Molecular Weight: 4327.18Salt Form: TFAPurity: >95%Sequence (3-letter): Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OHSequence (1-letter): VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD-OHStorage: -20 °C or belowBeta Amyloid (40-1) is an inactive control peptide for Beta Amyloid (1-40). The synthetic sequence is derived from the human Beta Amyloid (1-40). 

Supplier Catalog Number

641-70

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
From
€189.00
Total €189.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use