Beta Amyloid (1-40) rat - 5 mg

CAS Number: 144409-98-3Molecular Weight: 4231.14Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OHSequence (1-letter): DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-OHStorage: -20 °C or belowBeta Amyloid (1-40) rat is a form of the amyloid β-peptide found in plaques associated with Alzheimer's disease. It has both neurotrophic and neurotoxic effects and may affect synaptic plasticity.

Supplier Catalog Number

642-10

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
From
€2,309.00
Total €2,309.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use