Beta Amyloid (1-40) rat - 5 mg
CAS Number: 144409-98-3Molecular Weight: 4231.14Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OHSequence (1-letter): DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-OHStorage: -20 °C or belowBeta Amyloid (1-40) rat is a form of the amyloid β-peptide found in plaques associated with Alzheimer's disease. It has both neurotrophic and neurotoxic effects and may affect synaptic plasticity.
Supplier Catalog Number |
642-10 |
---|---|
Shipping conditions |
Room temperature |
Storage Temperature |
-20°C |
Supplier name |
Echelon Biosciences |
From
€2,309.00
Total
€2,309.00
In stock
- SKU
- P00386171::5 MG
No surprise after checkout. All fees included
Your satisfaction first: door delivery with guaranteed replacement
Dedicated Scientific Support to select & use
Recently Viewed Products
of