Adrenomedullin (22-52) human - 0.5 mg

CAS Number: 159899-65-7Molecular Weight: 3573.88Salt Form: TFAPurity: >96%Sequence (3-letter): Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2Sequence (1-letter): TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2Storage: -20 °C or belowAdrenomedullin (22-52) is an andrenomedullin (ADM) antagonist which blocks production of cAMP. In addition it antagonizes the calcitonin generelated peptide (CGRP) receptor.

Supplier Catalog Number

331-82

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
From
€341.00
Total €341.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use