Adrenomedullin (1-50) rat - 0.5 mg

CAS Number: 159964-38-2Molecular Weight: 5727.72Salt Form: TFAPurity: >96%Sequence (3-letter): Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 [Cys14-Cys19]Sequence (1-letter): YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2Storage: -20 °C or belowAdrenomedullin (ADM) is a peptide hormone isolated in 1993 from a pheochromocytoma a tumor of the adrenal medulla. ADM has roles in tumor progression regulating endometrial angiogenesis hypertension and cardiovascualar disease.

Supplier Catalog Number

335-75

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
From
€706.00
Total €706.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use