ACTH (7-38) human / Corticotropin Inhibiting Peptide (7-38) - 1 mg

CAS Number: 68563-24-6Molecular Weight: 3656.92Salt Form: TFAPurity: >96%Sequence (3-letter): Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OHSequence (1-letter): FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE-OHStorage: -20 °C or belowACTH (7-38) or Corticotropin Inhibiting Peptide (CIP) (7-38) is a fragment of Adrenocorticotropic Hormone which inhibits ACTH stimulated adenylate cyclase. It can acts as an antagonist of ACTH receptors.

Supplier Catalog Number

 111-45

Shipping conditions

 Room temperature

Storage Temperature

 -20°C

Supplier name

 Echelon Biosciences
From
€275.00
Total €275.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use