Beta Amyloid (1-42) rat - 0.5 mg

CAS Number: 166090-74-0Molecular Weight: 4415.26Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OHSequence (1-letter): DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OHStorage: -20 °C or belowSolubility: water 1 mg/mlBeta Amyloid (1-42) rat is the rat form of the predominant Beta amyloid peptide found in plaques associated with Alzheimer’s disease. It is homologous with the mouse peptide. In some animal models cognitive impairment and neurodegenerative disorders that mimic Alzheimer's disease can be reproduced by intracerebral or intracerebroventricular administration of beta amyloid peptide. Evidence suggests that oxidative stresses are involved in the mechanism of beta amyloid-induced neurotoxicity and Alzheimer’s disease pathogenesis. Exposure to beta amyloid increases lipid peroxidation protein oxidation and t

Supplier Catalog Number

642-15

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
From
NOK 4,680.00
Total NOK 4,680.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use