Beta Amyloid (1-42) human (Arctic) [Gly22] - 1 mg

CAS Number: 107761-42-2Molecular Weight: 4439.28Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OHSequence (1-letter): DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA-OHStorage: -20 °C or belowBeta amyloid (1-42) is the predominant form of β-amyloid protein found in the brains of patients with Alzheimer′s disease and Down′s syndrome. Beta Amyloid (1-42) human (Arctic) [Gly22] contains the Gly22 'Arctic' mutation which causes early onset of Alzheimer′s compared to wild type Beta amyloid (1-42).

Supplier Catalog Number

641-22

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
From
NOK 4,710.00
Total NOK 4,710.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use