Agatoxin IVa - 1 mg
CAS Number: 145017-83-0Molecular Weight: 5206.5Salt Form: TFAPurity: >95%Sequence (3-letter): Lys-Lys-Lys-Cys-Ile-Ala-Lys-Asp-Tyr-Gly-Arg-Cys-Lys-Trp-Gly-Gly-Thr-Pro-Cys-Cys-Arg-Gly-Arg-Gly-Cys-Ile-Cys-Ser-Ile-Met-Gly-Thr-Asn-Cys-Glu-Cys-Lys-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Gly-Leu-Ala-OH [Cys4-Cys20 Cys12-Cys25 Cys19-Cys36 Cys 27-Cys34]Sequence (1-letter): KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA-OHStorage: -20 °C or belowAgatoxin IVa is a toxic peptide found in the venom of the funnel web spider Agelenopsis aptera. Agatoxin IVa is a selective potent blocker of mammalian P-type voltage-dependent calcium channels. It is a potent and fast-acting neurotoxin.
Supplier Catalog Number |
429-15 |
---|---|
Shipping conditions |
Room temperature |
Storage Temperature |
-20°C |
Supplier name |
Echelon Biosciences |
From
NOKÂ 34,720.00
Total
NOKÂ 34,720.00
In stock
- SKU
- P00386000::1 mg
No surprise after checkout. All fees included
Your satisfaction first: door delivery with guaranteed replacement
Dedicated Scientific Support to select & use
Recently Viewed Products
of