Adrenomedullin (11-50) rat - 0.5 mg

CAS Number: 163648-32-6Molecular Weight: 4520.17Salt Form: TFAPurity: >96%Sequence (3-letter): Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2Sequence (1-letter): STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2Storage: -20 °C or belowAdrenomedullin (11-50) is the active C-terminal fragment of rat adrenomedullin. Adrenomedullin is thought to be a vasodilator and is found in high concentrations in the blood. It also stimulates angiogenesis and increases cellular tolerance to hypoxic injury and oxidative stress.

Supplier Catalog Number

335-80

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
CPV Codification12352209
Nacres CodificationNA.26
UNSPSC Codification33696500-0
From
NOK 5,250.00
Total NOK 5,250.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use