Adrenomedullin (1-52) human - 1 mg

CAS Number: 148498-78-6Molecular Weight: 6026.97Salt Form: TFAPurity: >95%Sequence (3-letter): Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 [Cys16-Cys21]Sequence (1-letter): YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2Storage: -20 °C or belowAdrenomedullin (ADM) is a peptide hormone isolated in 1993 from a pheochromocytoma a tumor of the adrenal medulla. ADM has roles in tumor progreession regulating endometrial angiogenesis hypertension and cardiovascualr disease.

Supplier Catalog Number

331-80

Shipping conditions

Room temperature

Storage Temperature

-20°C

Supplier name

Echelon Biosciences
From
NOK 11,400.00
Total NOK 11,400.00

No surprise after checkout. All fees included

Your satisfaction first: door delivery with guaranteed replacement

Dedicated Scientific Support to select & use