Adrenomedullin (1-52) human - 0.5 mg
CAS Number: 148498-78-6Molecular Weight: 6026.97Salt Form: TFAPurity: >95%Sequence (3-letter): Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 [Cys16-Cys21]Sequence (1-letter): YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2Storage: -20 °C or belowAdrenomedullin (ADM) is a peptide hormone isolated in 1993 from a pheochromocytoma a tumor of the adrenal medulla. ADM has roles in tumor progreession regulating endometrial angiogenesis hypertension and cardiovascualr disease.
Supplier Catalog Number |
331-80 |
---|---|
Shipping conditions |
Room temperature |
Storage Temperature |
-20°C |
Supplier name |
Echelon Biosciences |
From
NOKÂ 7,060.00
Total
NOKÂ 7,060.00
In stock
- SKU
- P00385973::0.5 mg
No surprise after checkout. All fees included
Your satisfaction first: door delivery with guaranteed replacement
Dedicated Scientific Support to select & use
Recently Viewed Products
of